Protein trichome birefringence-like 19

Author: ttbk

August undefined, 2024

WebbGene ID: 101210919, updated on 27-Mar-2024. Summary Other designations. protein trichome birefringence-like 19 WebbTrichomes on cpr5 mutants had reduced birefringence, ... endoreplication control, we asked whether there is a functional 3 (also called CPC-LIKE PROTEIN [CPL]), and …

The Seminavis robusta genome provides insights into the …

Webb1 feb. 2024 · In this paper, it was reviewed that the structure and morphology characteristics of trichomes, alongside the biological functions and classical regulatory … WebbProtein trichome birefringence-like 30 OS=Arabidopsis thaliana GN=TBL30 PE=2 SV=1: trembl. ID: ... probable inactive leucine-rich repeat receptor-like protein kinase ... latte selene bluetooth headset

Locus: AT5G15900 - arabidopsis.org

WebbMay act as a bridging protein that binds pectin and other cell wall polysaccharides. Probably involved in maintaining esterification of pectins (By similarity). May be involved … WebbProtein names Recommended name Protein trichome birefringence-like 1 Gene names Name TBL1 ORF names MEC18.19, T21B14.12 Ordered locus names At3g12060 … Webb15 mars 2024 · Cotton is an important fiber crop. The cotton fiber is an extremely long trichome that develops from the epidermis of an ovule. The trichome is a general and … lattes elizabeth diasm artins

Protein trichome birefringence-like 19 - genophore.com

WebbDue to cotton’s declining sustainability, more lignocellulosic materials are being used to produce dissolving pulp for textile applications. Pre-hydrolysis kraft is one of the main processes used to produce this material. Pre-hydrolysis under conventional conditions removes most of the hemicelluloses, but the majority end up as xylose and furfural, … WebbProtein trichome birefringence-like 19 OS=Arabidopsis thaliana: 0.03: Archaeplastida: AMTR_s00088p00114920: evm_27.TU.AmTr_v1... Protein ALTERED XYLOGLUCAN 4-like OS=Arabidopsis thaliana: 0.02: Archaeplastida: GSVIVT01032519001: No alias: Protein ALTERED XYLOGLUCAN 4-like OS=Arabidopsis thaliana: 0.04: just 6 crossword clueWebb(RefSeq) protein trichome birefringence-like 19. Organism: lang Lupinus angustifolius (narrow-leaved blue lupine) SSDB: Ortholog Paralog Gene cluster GFIT: Motif: Pfam: PC … lattes fernanda wanderer

"Webbgenome browser: aa seq: 440 aa aa seq db search mgiladlcyervishmsediwylnmklhtfeapsgnksvlwnfhkgillaltlilltiip plstnknlpsslpniwknttslktvelekkcdlfrgswvpkseqpyytndtcdmmfeyqn " - Protein trichome birefringence-like 19

Protein trichome birefringence-like 19

TRICHOME BIREFRINGENCE and Its Homolog AT5G01360

Webb7 apr. 2024 · 1.Introduction. Acidic soils (pH < 5.5) pose a significant challenge to global agriculture [1].Approximately 2.5 billion hectares of arable and potentially arable land, … Webb4 nov. 2024 · trichome birefringence-like protein (DUF828) RefSeq status REVIEWED Organism Arabidopsis thaliana (ecotype: Columbia) Lineage Eukaryota; Viridiplantae; …

Did you know?

WebbTwo grain amaranth transcription factor (TF) genies were overexpressed in Arabidopsis plants. The start, coding on a grouping VII ethylene retort factor TF (i.e., AhERF-VII) conferred tolerance to water-deficit stress (WS) in transgenic Arabidopsis without affecting veg or reproduction growth. A significantly lower water-loss rate in aloof quit coupled to … WebbAluminum (Al) toxicity on acidic soils significantly damages plant roots and inhibits root growth. Hence, crops intoxicated by Al become more sensitive to drought stress and mineral nutrient deficiencies, particularly phosphorus (P) deficiency, which is highly unavailable on tropical soils.

Webb1 mars 2002 · Protein Protein trichome birefringence-like 38 Gene TBL38 Status UniProtKB reviewed (Swiss-Prot) Organism Arabidopsis thaliana (Mouse-ear cress) … WebbProtein trichome birefringence-like 19 OS=Arabidopsis thaliana: 0.06: Archaeplastida: AMTR_s00006p00266110: evm_27.TU.AmTr_v1... Protein trichome birefringence-like 19 OS=Arabidopsis thaliana: 0.06: Archaeplastida: AMTR_s00006p00266250: evm_27.TU.AmTr_v1... Protein trichome birefringence-like 20 OS=Arabidopsis thaliana: …

Webbgenome browser: aa seq: 440 aa aa seq db search mgiladlcyervishmsediwylnmklhtfeapsgnksvlwnfhkgillaltlilltiip … WebbNext-day shipping cDNA ORF clones derived from LOC109233442 protein trichome birefringence-like 3 available at GenScript, starting from $99.00. SIGN IN. My Account …

http://ricefox.psc.riken.jp/rubber/Data/html/Hb_001511_210.html

Webb5 juni 2024 · TabHLH49 encoded 440 amino acids with a predicted protein molecular weight of 47.54 kDa and an isoelectric point of 5.61 (Fig. 1 a). This gene contained a … just 8n ford tractorsWebb20 jan. 2015 · Trichome_Birefringence_Like_proteins Home Gene Fams Keys News Docs Cite LINK 2015-01-20 Categories gene family Information. OsTBL1, LOC_Os12g01560, … lattes hasco bermudaWebbGene ID: 102586193, updated on 3-Jun-2024. Summary Other designations. protein trichome birefringence-like 19 lattes football clubWebb28 juni 2011 · Protein trichome birefringence-like 33 1 publication Gene names Name TBL33 1 publication ORF names T07M07.22, T7M7.12 Ordered locus names At2g40320 … just5 senior cell phone walmartWebbBioGRID COVID-19 Coronavirus Curation Project Search BioGRID for SARS-CoV-2 Protein Interactions ... Arabidopsis thaliana (Columbia) TBL25. F6F3.23, F6F3_23, TRICHOME BIREFRINGENCE-LIKE 25, AT1G01430. protein trichome birefringence-like 25. GO Process (0) GO Function (0) GO Component (0) TAIR Entrez Gene RefSeq UniprotKB . 22488. 3702. lattes fantasy bookWebb12 jan. 2024 · These genes included 11 disease-resistance proteins, 3 pathogenesis-related proteins, 4 RLP/RLKs, 2 CNGCs, 7 calcium-dependent protein kinases, 4 calcium … lattes footballWebbProtein trichome birefringence-like 30 OS=Arabidopsis thaliana GN=TBL30 PE=2 SV=1: trembl. ID: ... probable inactive leucine-rich repeat receptor-like protein kinase ... Hb_105148_020: 0.1123816869--PREDICTED: lysosomal Pro-X carboxypeptidase [Jatropha curcas] 19: Hb_000031_240: 0.1126544914--transferase, transferring glycosyl groups, … just 5 hair color walmart